Merck Anti-ATP6V1H antibody produced in rabbit
다른 상품 둘러보기
Anti-ATP6V1H antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ATP6V1H(51606)
The gene ATP6V1H (ATPase H+ transporting V1 subunit H) is mapped to human chromosome 8q11.2. It encodes a lysosomal protein with a molar mass of 50/57kDa. This protein forms the subunit of vacuolar ATPase (V-ATPase), a protein widely found in various eukaryotic endomembrane organelles. V-ATPase is a member of the rotary ATPase family, the members of which use rotary motor mechanisms for the transportation of ions across membranes. V-ATPase has two domains, V0 and V1 that function in transportation of proton and hydrolysis of ATP, respectively. The V1 domain is composed of eight subunits, A-H.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|