Merck Anti-RNF141 antibody produced in rabbit
토끼에서 생산된 Anti-RNF141 항체로, 인간 RNF141 단백질을 인식하는 polyclonal 1차 항체입니다. Prestige Antibodies® 제품군으로, 면역형광, 면역블롯, 면역조직화학 등 다양한 응용에 적합합니다. −20°C에서 보관하며, recombinant expression으로 검증되었습니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-RNF141 antibody produced in rabbit
Anti-RNF141 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| 향상된 검증 | Recombinant expression |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
실험 적용 (Applications)
| Technique | Working Concentration |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunofluorescence | 0.25–2 μg/mL |
| Immunohistochemistry | 1:50–1:200 |
Learn more about Antibody Enhanced Validation (EV).
면역원 서열 (Immunogen Sequence)
QLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDSSAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGRVKQLTDE
UniProt 수납 번호
Gene Information
Human RNF141 (Gene ID: 50862)
The gene RING finger protein-141 (RNF141) is located on human chromosome band 11p15.4. It produces two transcripts (1 kb and 4.4 kb). The shorter transcript is detected only in testicular tissue, while the longer one is expressed in heart, brain, skeletal muscle, kidney, and pancreas. The protein contains a C3HC3-type zinc finger motif. In human semen protein fractions, RNF141 signals are observed in the sperm acrosome and tail. Expression in COS cells shows predominant nuclear localization.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.