Merck Anti-RNF141 antibody produced in rabbit
다른 상품 둘러보기
Anti-RNF141 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
QLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDSSAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGRVKQLTDE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... RNF141(50862)
The gene RING finger protein-141 (RNF141) has been mapped to human chromosome band 11p15.4. The gene gives two transcripts of 1 kb and 4.4 kb length. The shorter transcript is detected only in testicular tissue whereas the longer one is detected in other tissues (heart, brain, skeletal muscle, kidney and pancreas). The protein contains a C3HC3-type zinc finger protein motif. In protein fractions of human semen RNF141 showed the signal in the sperm acrosome and tail. Expression of RNF141 in the COS cells showed protein localization mainly in the nucleus.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|