
Merck Anti-LRWD1 antibody produced in rabbit
토끼에서 생산된 Anti-LRWD1 polyclonal 항체로, 인간 단백질 LRWD1을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로, immunofluorescence 및 immunohistochemistry에 적합합니다. 정제된 glycerol 완충 용액 형태로 제공되며, −20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LRWD1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies 제품으로, rabbit에서 생산된 affinity isolated polyclonal 항체입니다. Buffered aqueous glycerol solution 형태로 제공됩니다.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Antibody Type | Primary antibody |
| Clone | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | Small pack of 25 μL |
| Enhanced Validation | Orthogonal RNAseq |
| Techniques | Immunofluorescence (0.25–2 μg/mL), Immunohistochemistry (1:50–1:200) |
| Immunogen Sequence | PFLTVNDNLKVSFLLPTLRKVNGKDASSTYSQVENLNRELTSRVTAHWEKFMATLGPEEEAEKAQADFVKSAVRD |
| UniProt Accession No. | Q9UFC0 |
| Shipping Conditions | Wet ice |
| Storage Temperature | −20 °C |
Gene Information
Gene: LRWD1 (222229)
Description: The LRWD1 (leucine-rich repeat and WD repeat-containing protein 1) gene is located on human chromosome 7q22.1. The protein contains leucine-rich repeat and WD40 (β-transducin) domains. LRWD1 is expressed in the cytoplasm of spermatocytes and spermatids, and co-localizes with centrosomes in the sperm tail.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-OXSM antibody produced in rabbit
895,600원

Merck Sigma
Merck Anti-C9orf135 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-LRWD1 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-RNF141 antibody produced in rabbit
895,600원

Merck Sigma
Merck Anti-CPA2 antibody produced in rabbit
895,600원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|