AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-LRWD1 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-LRWD1 polyclonal 항체로, 인간 단백질 LRWD1을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로, immunofluorescence 및 immunohistochemistry에 적합합니다. 정제된 glycerol 완충 용액 형태로 제공되며, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA021320-100UL Anti-LRWD1 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-LRWD1 antibody produced in rabbit
Anti-LRWD1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies 제품으로, rabbit에서 생산된 affinity isolated polyclonal 항체입니다. Buffered aqueous glycerol solution 형태로 제공됩니다.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Antibody Type | Primary antibody |
| Clone | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | Small pack of 25 μL |
| Enhanced Validation | Orthogonal RNAseq |
| Techniques | Immunofluorescence (0.25–2 μg/mL), Immunohistochemistry (1:50–1:200) |
| Immunogen Sequence | PFLTVNDNLKVSFLLPTLRKVNGKDASSTYSQVENLNRELTSRVTAHWEKFMATLGPEEEAEKAQADFVKSAVRD |
| UniProt Accession No. | Q9UFC0 |
| Shipping Conditions | Wet ice |
| Storage Temperature | −20 °C |
Gene Information
Gene: LRWD1 (222229)
Description: The LRWD1 (leucine-rich repeat and WD repeat-containing protein 1) gene is located on human chromosome 7q22.1. The protein contains leucine-rich repeat and WD40 (β-transducin) domains. LRWD1 is expressed in the cytoplasm of spermatocytes and spermatids, and co-localizes with centrosomes in the sperm tail.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.