Merck Anti-AQP4 antibody produced in rabbit
다른 상품 둘러보기
Anti-AQP4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, mouse
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:2500-1:5000
면역원 서열
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... AQP4(361)
AQP4 (aquaporin 4) is an intrinsic protein, and belongs to the family of aquaporin water channels, which consists of thirteen members. This gene is localized to human chromosome 18 q11-q12, and has four exons and three introns. The encoded protein has five loops, intervened by six transmembrane domains. Loops A, C and E face the extraplasmic region, and loops B and D are present in the cytoplasmic region. It is expressed in peripheral organs such as, lung, stomach and kidney. It is the predominant water channel expressed in central nervous system. It is expressed by astrocytes, and localizes preferentially to end-foot processes of astrocytes. It is present as two alternatively spliced forms- long one called M1 and the short one named M23.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|