Atlas Antibodies Anti-TEX38 Antibody

상품 한눈에 보기

Human TEX38 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. 면역형광(ICC) 등의 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human 반응성이 검증되었으며, 40% glycerol/PBS buffer에 보존됩니다.

카탈로그번호: HPA073711-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA073711-100 Anti-TEX38 Antibody, testis expressed 38 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA073711-25 Anti-TEX38 Antibody, testis expressed 38 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TEX38 Antibody

Anti-TEX38 Antibody

Target Information

Target Protein: Testis expressed 38
Target Gene: TEX38
Alternative Gene Names: ATPAF1-AS1, C1orf223, LOC374973, THEG4

Product Description

Polyclonal Antibody against Human TEX38.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
HWRKNLRREEHAQQWVEVMRAATFTYSPLLYWINKRRRYGMNAAINTGPAPAVTKTETEVQNPDVLWDLD

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse (ENSMUSG00000044556): 83%
Rat (ENSRNOG00000010162): 81%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	Immunocytochemistry (ICC)
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.