
Atlas Antibodies Anti-TEX38 Antibody
상품 한눈에 보기
Human TEX38 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. 면역형광(ICC) 등의 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human 반응성이 검증되었으며, 40% glycerol/PBS buffer에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TEX38 Antibody
Target Information
- Target Protein: Testis expressed 38
- Target Gene: TEX38
- Alternative Gene Names: ATPAF1-AS1, C1orf223, LOC374973, THEG4
Product Description
Polyclonal Antibody against Human TEX38.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:HWRKNLRREEHAQQWVEVMRAATFTYSPLLYWINKRRRYGMNAAINTGPAPAVTKTETEVQNPDVLWDLD
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000044556): 83%
- Rat (ENSRNOG00000010162): 81%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Recommended Applications | Immunocytochemistry (ICC) |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
