Atlas Antibodies Anti-TEX44 Antibody

상품 한눈에 보기

Human TEX44 단백질을 인식하는 토끼 폴리클로날 항체로, 정소 특이적 발현 단백질 연구에 적합합니다. IHC Orthogonal 검증을 통해 RNA-seq 데이터와 단백질 발현을 교차 확인하였습니다. Affinity 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호: HPA049917-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA049917-100 Anti-TEX44 Antibody, testis expressed 44 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA049917-25 Anti-TEX44 Antibody, testis expressed 44 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TEX44 Antibody

Anti-TEX44 Antibody

Target: testis expressed 44 (TEX44)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human TEX44.

Alternative Gene Names

C2orf57, MGC35154

Open Datasheet (PDF)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
LGNVDDSRSKDSPAGEPQGQVPLTADVLAVSSSVASTDWQDIDQASFKTATPRAISTSGDKDKSAVVPEHGQKTPRKITPLLPSQNPSPLQVS

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000030247	28%
Mouse	ENSMUSG00000021366	28%

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet