CacheBy
Atlas Antibodies Anti-TF Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TF Antibody

상품 한눈에 보기

인체 TF(transferrin)을 타깃으로 하는 토끼 폴리클로날 항체. IHC 및 WB에서 독립 항체 비교를 통한 검증 완료. PrEST 항원을 이용한 친화 정제. 인간 반응성 확인, 40% 글리세롤 및 PBS 완충액으로 안정화.

카탈로그번호
HPA005692-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA005692-100 Anti-TF Antibody, transferrin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005692-25 Anti-TF Antibody, transferrin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TF Antibody

Anti-TF Antibody

Target: Transferrin (TF)
Type: Polyclonal Antibody against Human TF
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody raised in rabbit against human TF (transferrin).


Alternative Gene Names

PRO1557, PRO2086

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    DGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKA

Species Reactivity

Species Reactivity Gene ID / Ortholog Sequence Identity
Human Verified TF 100%
Rat Predicted ENSRNOG00000030625 78%
Mouse Predicted ENSMUSG00000032554 78%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.