
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TF Antibody
상품 한눈에 보기
인체 TF(transferrin)을 타깃으로 하는 토끼 폴리클로날 항체. IHC 및 WB에서 독립 항체 비교를 통한 검증 완료. PrEST 항원을 이용한 친화 정제. 인간 반응성 확인, 40% 글리세롤 및 PBS 완충액으로 안정화.
- 카탈로그번호
- HPA005692-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA005692-100 Anti-TF Antibody, transferrin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005692-25 Anti-TF Antibody, transferrin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TF Antibody
Anti-TF Antibody
Target: Transferrin (TF)
Type: Polyclonal Antibody against Human TF
Supplier: Atlas Antibodies
Recommended Applications
IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against human TF (transferrin).
Alternative Gene Names
PRO1557, PRO2086
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
DGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKA
Species Reactivity
| Species | Reactivity | Gene ID / Ortholog | Sequence Identity |
|---|---|---|---|
| Human | Verified | TF | 100% |
| Rat | Predicted | ENSRNOG00000030625 | 78% |
| Mouse | Predicted | ENSMUSG00000032554 | 78% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



