Atlas Antibodies Anti-TCF25 Antibody
상품 한눈에 보기
인간 TCF25 단백질을 표적으로 하는 폴리클로날 토끼 항체. IHC 및 WB 애플리케이션에 적합하며, 독립 항체 비교 및 재조합 발현 검증으로 품질 향상. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TCF25 Antibody
transcription factor 25 (basic helix-loop-helix)
Recommended Applications
IHC (Independent antibody validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Recombinant expression validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human TCF25
Alternative Gene Names: KIAA1049, Nulp1
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transcription factor 25 (basic helix-loop-helix) |
| Target Gene | TCF25 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Highest antigen sequence identity to the following orthologs: • Rat ENSRNOG00000017023 (97%) • Mouse ENSMUSG00000001472 (97%) |
Antigen Sequence:
SPYHVDSLLQLSDACRFQEDQEMARDLVERALYSMECAFHPLFSLTSGACRLDYRRPENRSFYLALYKQMSFLEKRGCPRTALEYCKLILSLEPDE
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.