Atlas Antibodies Anti-TCF25 Antibody

상품 한눈에 보기

인간 TCF25 단백질을 표적으로 하는 폴리클로날 토끼 항체. IHC 및 WB 애플리케이션에 적합하며, 독립 항체 비교 및 재조합 발현 검증으로 품질 향상. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041699-100 Anti-TCF25 Antibody, transcription factor 25 (basic helix-loop-helix) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041699-25 Anti-TCF25 Antibody, transcription factor 25 (basic helix-loop-helix) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

transcription factor 25 (basic helix-loop-helix)

IHC (Independent antibody validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Recombinant expression validation)
Recombinant expression validation in WB using target protein overexpression.

Polyclonal Antibody against Human TCF25

Alternative Gene Names: KIAA1049, Nulp1
Open Datasheet (PDF)

항목	내용
Target Protein	transcription factor 25 (basic helix-loop-helix)
Target Gene	TCF25
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Highest antigen sequence identity to the following orthologs: • Rat ENSRNOG00000017023 (97%) • Mouse ENSMUSG00000001472 (97%)

Antigen Sequence:
SPYHVDSLLQLSDACRFQEDQEMARDLVERALYSMECAFHPLFSLTSGACRLDYRRPENRSFYLALYKQMSFLEKRGCPRTALEYCKLILSLEPDE

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand