CacheBy
Atlas Antibodies Anti-TCF25 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TCF25 Antibody

상품 한눈에 보기

인간 TCF25 단백질을 타깃으로 하는 토끼 폴리클로날 항체입니다. IHC 및 WB 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 40% 글리세롤 및 PBS 완충액에 보존되어 장기 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA041786-100 Anti-TCF25 Antibody, transcription factor 25 (basic helix-loop-helix) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041786-25 Anti-TCF25 Antibody, transcription factor 25 (basic helix-loop-helix) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCF25 Antibody

Anti-TCF25 Antibody

Target: Transcription factor 25 (basic helix-loop-helix)
Supplier: Atlas Antibodies


  • IHC (Independent Antibody Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against human TCF25.


Alternative Gene Names

KIAA1049, Nulp1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Transcription factor 25 (basic helix-loop-helix)
Target Gene TCF25
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000001472 (97%), Rat ENSRNOG00000017023 (97%)

Antigen Sequence:

SPYHVDSLLQLSDACRFQEDQEMARDLVERALYSMECAFHPLFSLTSGACRLDYRRPENRSFYLALYKQMSFLEKRGCPRTALEYCKLILSLEPDE

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.