CacheBy
Atlas Antibodies Anti-TCF3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TCF3 Antibody

상품 한눈에 보기

Human TCF3 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, 다양한 전사인자 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA049808-100 Anti-TCF3 Antibody, transcription factor 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049808-25 Anti-TCF3 Antibody, transcription factor 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCF3 Antibody

Anti-TCF3 Antibody

Target: Transcription Factor 3 (TCF3)
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against human TCF3, a transcription factor involved in gene regulation. Suitable for use in immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.

Alternative Gene Names

bHLHb21, E2A, E47, ITF1, MGC129647, MGC129648, VDIR

Target Information

항목 내용
Target Protein Transcription Factor 3
Target Gene TCF3
Verified Species Reactivity Human
Interspecies Identity Mouse (74%), Rat (71%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined experimentally.
  • Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.