
Atlas Antibodies Anti-TCF12 Antibody
Human TCF12 단백질을 표적으로 하는 폴리클로날 토끼 항체로, 전사 인자 연구에 적합함. Recombinant PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 면역세포 염색 등 다양한 응용 가능. Human, Rat, Mouse 종에 반응.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TCF12 Antibody
Target Information
- Target Protein: Transcription Factor 12
- Target Gene: TCF12
- Alternative Gene Names: bHLHb20, HEB, HsT17266, HTF4
Product Description
Polyclonal antibody against human TCF12.
Affinity purified using the PrEST antigen as affinity ligand.
Recommended for applications including immunocytochemistry (ICC).
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
FSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSWGTSGQPSPSYDSSRGFTDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLYSRDTGLPGCQSSLLRQDLGLGSPAQLSSSGKPGTAYYSFSATSSRRRP
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat: ENSRNOG00000057754 (96%)
- Mouse: ENSMUSG00000032228 (96%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage | Gently mix before use. Determine optimal concentration and conditions experimentally. |
Reference Documents
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TCERG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCF19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCF12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCERG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCEANC2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|