CacheBy
Atlas Antibodies Anti-TCERG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TCERG1 Antibody

상품 한눈에 보기

인간 TCERG1 단백질을 인식하는 폴리클로날 항체로, IHC 정량 분석 및 RNA-seq 데이터 기반 정합 검증에 적합합니다. 토끼 유래 IgG 항체이며, 40% 글리세롤과 PBS 완충액에 보존됩니다. 고순도 Affinity 정제 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA069752-100 Anti-TCERG1 Antibody, transcription elongation regulator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069752-25 Anti-TCERG1 Antibody, transcription elongation regulator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCERG1 Antibody

Anti-TCERG1 Antibody

Target: Transcription elongation regulator 1 (TCERG1)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human TCERG1


Alternative Gene Names

CA150, TAF2S, Urn1

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein Transcription elongation regulator 1
Target Gene TCERG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKV
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000024498 (100%), Rat ENSRNOG00000018849 (100%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.