CacheBy
Atlas Antibodies Anti-TCERG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TCERG1 Antibody

상품 한눈에 보기

Human TCERG1 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 Orthogonal Validation에 적합. Rabbit 유래 IgG 형식이며, PrEST 항원으로 친화 정제됨. 인체, Rat, Mouse에서 100% 반응성 확인.

카탈로그번호
HPA069808-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069808-100 Anti-TCERG1 Antibody, transcription elongation regulator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069808-25 Anti-TCERG1 Antibody, transcription elongation regulator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCERG1 Antibody

Anti-TCERG1 Antibody

Target: Transcription elongation regulator 1 (TCERG1)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human TCERG1


Alternative Gene Names

  • CA150
  • TAF2S
  • Urn1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Transcription elongation regulator 1
Target Gene TCERG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKV
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000018849 (100%)
Mouse ENSMUSG00000024498 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.