CacheBy
Atlas Antibodies Anti-TAF8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TAF8 Antibody

상품 한눈에 보기

TAF8 단백질을 인식하는 사람 유래 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 재조합 발현 검증을 통해 신뢰성 확보. 토끼 숙주에서 생산되었으며, 친화 정제 방식으로 높은 특이도와 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031730-100 Anti-TAF8 Antibody, TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031730-25 Anti-TAF8 Antibody, TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TAF8 Antibody

Anti-TAF8 Antibody

TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa

  • IHC (Immunohistochemistry)
  • WB (Western Blot) — Recombinant expression validation using target protein overexpression
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human TAF8

Alternative Gene Names

FLJ32821, TAF(II)43, TBN

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
Target Gene TAF8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
PHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYL
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000015249 (100%), Mouse ENSMUSG00000023980 (99%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.