Atlas Antibodies Anti-TAF8 Antibody
상품 한눈에 보기
TAF8 단백질을 인식하는 사람 유래 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 재조합 발현 검증을 통해 신뢰성 확보. 토끼 숙주에서 생산되었으며, 친화 정제 방식으로 높은 특이도와 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TAF8 Antibody
TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) — Recombinant expression validation using target protein overexpression
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human TAF8
Alternative Gene Names
FLJ32821, TAF(II)43, TBN
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa |
| Target Gene | TAF8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYL |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000015249 (100%), Mouse ENSMUSG00000023980 (99%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.