CacheBy
Atlas Antibodies Anti-TAF6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TAF6 Antibody

상품 한눈에 보기

TAF6 단백질을 인식하는 사람 유래 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. 토끼에서 생산된 IgG 항체이며, 고순도 친화 정제 방식으로 제조됨. 인간, 생쥐, 랫드 간 높은 항원 서열 일치율을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006566-100 Anti-TAF6 Antibody, TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006566-25 Anti-TAF6 Antibody, TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TAF6 Antibody

Anti-TAF6 Antibody

TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TAF6.

Alternative Gene Names

MGC:8964, TAF2E, TAFII70, TAFII80, TAFII85

Open Datasheet

Target Information

항목 내용
Target Protein TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
Target Gene TAF6
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000036980 (98%), Rat ENSRNOG00000001355 (98%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.