CacheBy
Atlas Antibodies Anti-TAF7L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TAF7L Antibody

상품 한눈에 보기

TAF7L 단백질을 인식하는 사람 유래 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제됨. Human에 대해 검증된 반응성을 보유. 연구용으로 안정적인 PBS/glycerol 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001879-100 Anti-TAF7L Antibody, TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001879-25 Anti-TAF7L Antibody, TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TAF7L Antibody

Anti-TAF7L Antibody

TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human TAF7L

Alternative Gene Names

CT40, TAF2Q

Open Datasheet

Target Information

항목 내용
Target Protein TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa
Target Gene TAF7L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000022632 (68%), Mouse ENSMUSG00000074734 (65%)

Antigen Sequence

ESQDEVPDEVENQFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRK

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.