CacheBy
Atlas Antibodies Anti-TACO1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TACO1 Antibody

상품 한눈에 보기

Human TACO1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 사람, 생쥐, 랫드 반응성이 검증되었습니다. 미토콘드리아 시토크롬 c 산화효소 I 번역 활성화 단백질 연구에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024294-100 Anti-TACO1 Antibody, translational activator of mitochondrially encoded cytochrome c oxidase I 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024294-25 Anti-TACO1 Antibody, translational activator of mitochondrially encoded cytochrome c oxidase I 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TACO1 Antibody

Anti-TACO1 Antibody

Target: Translational activator of mitochondrially encoded cytochrome c oxidase I
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

  • ICC (Immunocytochemistry)


Product Description

Polyclonal antibody against Human TACO1.


Alternative Gene Names

  • CCDC44

Open Datasheet


Target Information

항목 내용
Target Protein Translational activator of mitochondrially encoded cytochrome c oxidase I
Target Gene TACO1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence FKFICDASSLHQVRKKLDSLGLCSVSCALEFIPNSKVQLAEPDLEQAAHLIQALSNHEDVIHVYDNI
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000008405 (93%), Mouse ENSMUSG00000001983 (90%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Validation
WB Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.