Atlas Antibodies Anti-TACO1 Antibody

상품 한눈에 보기

Human TACO1 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 검증을 통해 신뢰성 확보. Human, Mouse, Rat에 반응하며 PrEST 항원을 이용해 친화 정제됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA021626-100 Anti-TACO1 Antibody, translational activator of mitochondrially encoded cytochrome c oxidase I 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA021626-25 Anti-TACO1 Antibody, translational activator of mitochondrially encoded cytochrome c oxidase I 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Translational activator of mitochondrially encoded cytochrome c oxidase I

IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal antibody against Human TACO1.

항목	내용
Target Protein	Translational activator of mitochondrially encoded cytochrome c oxidase I
Target Gene	TACO1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	FKFICDASSLHQVRKKLDSLGLCSVSCALEFIPNSKVQLAEPDLEQAAHLIQALSNHEDVIHVYDNI
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Rat ENSRNOG00000008405 (93%), Mouse ENSMUSG00000001983 (90%)