
1 / 2
Atlas Antibodies Anti-TACC3 Antibody
상품 한눈에 보기
Human TACC3 단백질을 인식하는 토끼 다클론 항체로, IHC 및 WB에 적합합니다. siRNA 노크다운으로 유전적 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 글리세롤 기반 완충액에 보존되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TACC3 Antibody
Transforming, acidic coiled-coil containing protein 3 (TACC3)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human TACC3
Alternative Gene Names
- ERIC1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Transforming, acidic coiled-coil containing protein 3 |
| Target Gene | TACC3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKEN |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000017259 | 75% |
| Mouse | ENSMUSG00000037313 | 67% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TACO1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TACR2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TACC3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TACC3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TACC2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.