Thermo Fisher Scientific CCL4 Polyclonal Antibody
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
PA128319 | - | Thermo Fisher Scientific PA128319 CCL4 Polyclonal Antibody 50 ug pk | 재고문의 | pk | 0원 | - | 0원 |
다른 상품 둘러보기
Applications
Tested Dilution
Publications
Western Blot (WB)
1:500
ELISA (ELISA)
Assay-dependent
Product Specifications
Host/Isotype
Chicken / IgY
Class
Polyclonal
Type
Antibody
Immunogen
synthetic peptide GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN, corresponding to amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta.
Conjugate
Unconjugated Unconjugated Unconjugated
Form
Liquid
Concentration
1 mg/mL
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions
Wet ice
RRID
AB_2071174
Product Specific Information
PA1-28319 detects CCL4 from human samples.
Target Information
CCL4 (macrophage inflammatory protein 1-beta, MIP1B) belongs to the intercrine beta (chemokine CC) family. Functionally, CCL4 is involved in chemotactic and proinflammatory effects, and homeostasis. CCL4 is produced by macrophages upon stimulation by bacterial endotoxins. CCL4 recruits and stimulates various inflammatory cells at sites of inflammation. CCL4 is produced by lymphocytes, macrophages and dendritic cells. Both CCL4 and the related protein CCL3 participate in the host response to invading bacterial, viral, parasite and fungal pathogens by regulating the trafficking and activation state of selected subgroups of inflammatory cells. While both CCL4 and CCL3 exert similar effects on monocytes, their effect on lymphocytes differ, with CCL4 selectively attracting CD4+ lymphocytes and CCL3 selectively attracting CD8+ lymphocytes. Additionally, both have been shown to be potent chemoattractants for B cells, eosinophils and dendritic cells. The processed form of CCL4 can induce down-modulation of surface expression of the chemokine receptor CCR5, thus inhibiting the CCR5-mediated entry of HIV-1 in T cells. CCL4 binds with high affinity to CCR5 receptors.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|