Thermo Fisher Scientific NKG2D (CD314) Polyclonal Antibody
Thermo Fisher Scientific의 NKG2D (CD314) Polyclonal Antibody는 인간, 마우스, 랫트에서 반응하며 Rabbit IgG로 제작된 항체입니다. Western blot에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 연구용으로 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human NKG2D (YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746685 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. NK cells regulate specific humoral and cell-mediated immunity and preferentially express several calcium-dependent (C-type) lectins involved in NK cell function regulation.
The NK gene encodes a member of the NKG2 family, characterized by a type II membrane orientation (extracellular C terminus) and a C-type lectin domain. The NKG2 gene family is located within the NK complex, containing several C-type lectin genes preferentially expressed in NK cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Laminin gamma-1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CD171 (L1CAM) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NKG2D (CD314) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Bradykinin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Laminin alpha-2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|