Thermo Fisher Scientific Bradykinin Polyclonal Antibody
Bradykinin을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, Western blot과 IHC(P) 실험에 적합합니다. Mouse 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 -20°C에서 보관합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Bradykinin Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227–259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEAL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746686 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Kininogen-1 (KNG1), also known as BDK or bradykinin, is encoded by the KNG1 gene located at 3q27.3 in humans.
The KNG1 gene undergoes alternative splicing to produce two distinct proteins: high-molecular-weight kininogen (HMWK) and low-molecular-weight kininogen (LMWK).
- HMWK: Essential for blood coagulation and assembly of the kallikrein-kinin system.
- LMWK: Not involved in blood coagulation.
KNG1 functions as a constituent of both the blood coagulation system and the kinin-kallikrein system, with bradykinin being a peptide causing multiple physiological effects.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음 – OCR 텍스트만 통합됨)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.