Thermo Fisher Scientific Bradykinin Polyclonal Antibody
Bradykinin을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, Western blot과 IHC(P) 실험에 적합합니다. Mouse 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 -20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227–259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEAL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746686 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Kininogen-1 (KNG1), also known as BDK or bradykinin, is encoded by the KNG1 gene located at 3q27.3 in humans.
The KNG1 gene undergoes alternative splicing to produce two distinct proteins: high-molecular-weight kininogen (HMWK) and low-molecular-weight kininogen (LMWK).
- HMWK: Essential for blood coagulation and assembly of the kallikrein-kinin system.
- LMWK: Not involved in blood coagulation.
KNG1 functions as a constituent of both the blood coagulation system and the kinin-kallikrein system, with bradykinin being a peptide causing multiple physiological effects.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음 – OCR 텍스트만 통합됨)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CD171 (L1CAM) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NKG2D (CD314) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Bradykinin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Laminin alpha-2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Kallikrein 2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|