원본
Thermo Fisher Scientific Aquaporin 1 Polyclonal Antibody
상품 한눈에 보기
Aquaporin 1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC, Flow Cytometry 등에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결 건조 형태로 제공. 연구용으로만 사용.
- 카탈로그번호
- PA578806
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 04:58
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA578806 Aquaporin 1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific Aquaporin 1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | - | 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL | 1 publication |
| Immunocytochemistry (ICC/IF) | 5 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells | - |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Not Applicable |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240–269aa: DRVKVWTSGQVEEYDLDADDINSRVEMKPK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745922 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Aquaporin 1 (AQP1) is a 28 kDa integral membrane protein originally identified in red blood cells and renal proximal tubules. It is also expressed in the choroid plexus and various other tissues. AQP1 forms a water-specific channel that provides plasma membranes of red cells and kidney proximal tubules with high water permeability, allowing water movement along osmotic gradients.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific Aquaporin 5 Polyclonal Antibody514,100원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific AQP11 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific APRT Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Aquaporin 2 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.