
Thermo Fisher Scientific Aquaporin 1 Polyclonal Antibody
Aquaporin 1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC, Flow Cytometry 등에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결 건조 형태로 제공. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | - | 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL | 1 publication |
| Immunocytochemistry (ICC/IF) | 5 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells | - |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Not Applicable |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240–269aa: DRVKVWTSGQVEEYDLDADDINSRVEMKPK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745922 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Aquaporin 1 (AQP1) is a 28 kDa integral membrane protein originally identified in red blood cells and renal proximal tubules. It is also expressed in the choroid plexus and various other tissues. AQP1 forms a water-specific channel that provides plasma membranes of red cells and kidney proximal tubules with high water permeability, allowing water movement along osmotic gradients.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 5 Polyclonal Antibody
514,100원

Thermo Fisher Scientific
Thermo Fisher Scientific AQP11 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific APRT Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|