Thermo Fisher Scientific E2F1 Polyclonal Antibody
E2F1 단백질을 인식하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot, ELISA, IP 등에 사용 가능하며, 고순도의 Affinity chromatography로 정제되었습니다. 세포 주기 조절 및 종양 억제 단백질 연구에 적합합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific E2F1 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:50–1:250 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to amino acids 58–93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage buffer | Proprietary buffer, pH 7.4–7.8, with 30% glycerol, 0.5% BSA |
| Contains | 0.02% sodium azide |
| Storage conditions | −20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
Target Information
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of the cell cycle and the action of tumor suppressor proteins, and is also a target of the transforming proteins of small DNA tumor viruses.
E2F proteins contain several evolutionarily conserved domains, including a DNA-binding domain, a dimerization domain interacting with DP proteins, a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain embedded within the transactivation domain.
E2F1, along with E2F2 and E2F3, has an additional cyclin-binding domain and binds preferentially to retinoblastoma protein (pRB) in a cell-cycle–dependent manner. It can mediate both cell proliferation and p53-dependent or independent apoptosis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.