Thermo Fisher Scientific E2F1 Polyclonal Antibody
E2F1 단백질을 인식하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot, ELISA, IP 등에 사용 가능하며, 고순도의 Affinity chromatography로 정제되었습니다. 세포 주기 조절 및 종양 억제 단백질 연구에 적합합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:50–1:250 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to amino acids 58–93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage buffer | Proprietary buffer, pH 7.4–7.8, with 30% glycerol, 0.5% BSA |
| Contains | 0.02% sodium azide |
| Storage conditions | −20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
Target Information
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of the cell cycle and the action of tumor suppressor proteins, and is also a target of the transforming proteins of small DNA tumor viruses.
E2F proteins contain several evolutionarily conserved domains, including a DNA-binding domain, a dimerization domain interacting with DP proteins, a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain embedded within the transactivation domain.
E2F1, along with E2F2 and E2F3, has an additional cyclin-binding domain and binds preferentially to retinoblastoma protein (pRB) in a cell-cycle–dependent manner. It can mediate both cell proliferation and p53-dependent or independent apoptosis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific E2F1 Polyclonal Antibody
499,600원
Thermo Fisher Scientific
Thermo Fisher Scientific E2F1 Polyclonal Antibody, Biotin
594,400원
Thermo Fisher Scientific
Thermo Fisher Scientific E2F1 Polyclonal Antibody
499,600원
Thermo Fisher Scientific
Thermo Fisher Scientific Escherichia coli (K-12 strain) BioParticles, Texas Red conjugate
417,400원
Thermo Fisher Scientific
Thermo Fisher Scientific Escherichia coli BioParticles Opsonizing Reagent
425,300원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|