Thermo Fisher Scientific FMRP Polyclonal Antibody
Rabbit polyclonal antibody against human FMRP for WB, IHC, and ICC applications. High specificity and affinity purified. Lyophilized form, reconstitutable to 500 µg/mL. Suitable for research use in studying fragile X syndrome and RNA-binding protein FMR1.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to N-terminus of human FMRP (164–200aa: ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746394 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
FMR1 binds RNA and associates with polysomes. It may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat in the 5′ UTR normally ranges from 6–53 copies, but expansions to 55–230 repeats cause fragile X syndrome. Such expansions may also lead to premature ovarian failure. Multiple alternatively spliced transcript variants encoding different protein isoforms with distinct cellular localizations have been described.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific FosB Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FMO4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FMRP Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FNDC5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FMO5 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|