Thermo Fisher Scientific FMRP Polyclonal Antibody
Rabbit polyclonal antibody against human FMRP for WB, IHC, and ICC applications. High specificity and affinity purified. Lyophilized form, reconstitutable to 500 µg/mL. Suitable for research use in studying fragile X syndrome and RNA-binding protein FMR1.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific FMRP Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to N-terminus of human FMRP (164–200aa: ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746394 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
FMR1 binds RNA and associates with polysomes. It may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat in the 5′ UTR normally ranges from 6–53 copies, but expansions to 55–230 repeats cause fragile X syndrome. Such expansions may also lead to premature ovarian failure. Multiple alternatively spliced transcript variants encoding different protein isoforms with distinct cellular localizations have been described.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.