Thermo Fisher Scientific MICA Polyclonal Antibody
인간 MICA 단백질을 인식하는 Rabbit Polyclonal Antibody로 Western blot에 적합합니다. 합성 펩타이드(C-말단, 304–334aa)를 면역원으로 사용하였으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 -20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- Publications: [References not provided]
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MICA (304–334aa QSHWQTFHVSAVAAAAKFVEIIFYVRCCKKK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.01 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746786 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Major histocompatibility complex (MHC) class I proteins are ubiquitously expressed and mediate the recognition of intracellular antigens by cytotoxic T cells.
A related family, termed the MHC class I chain-related (MIC) proteins, are recognized by NKG2D, a receptor on NK and T cells, and promote anti-tumor activity.
MICA, a member of the MIC family, is widely expressed on many tumors, and the MICA/NKG2D interaction is thought to stimulate anti-tumor reactivity by T lymphocytes.
Both MICA and MICB mRNA are widely expressed in normal tissues, with MICA being present in virtually every tissue except the nervous system, suggesting that MIC protein expression may only be one component of the anti-tumor activity of the immune system.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 0 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 0 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MICA Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MGST1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MGP Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|