Atlas Antibodies Anti-SUCLA2 Antibody
상품 한눈에 보기
Human SUCLA2 단백질을 타겟으로 하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 독립적 검증 완료. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성 제공. Human, Mouse 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SUCLA2 Antibody
Target: succinate-CoA ligase, ADP-forming, beta subunit
Supplier: Atlas Antibodies
Type: Polyclonal Antibody against Human SUCLA2
Recommended Applications
- IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against Human SUCLA2.
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | succinate-CoA ligase, ADP-forming, beta subunit |
| Target Gene | SUCLA2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | FGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLP |
Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human, Mouse |
| Interspecies Information | Mouse ENSMUSG00000022110 (96%), Rat ENSRNOG00000017481 (95%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-SUB1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-SUCLG1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-SUCLA2 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-SUCLG2 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-SUCLG2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.