CacheBy
Atlas Antibodies Anti-SUCLA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SUCLA2 Antibody

상품 한눈에 보기

Human SUCLA2 단백질을 타겟으로 하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 독립적 검증 완료. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성 제공. Human, Mouse 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039536-100 Anti-SUCLA2 Antibody, succinate-CoA ligase, ADP-forming, beta subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039536-25 Anti-SUCLA2 Antibody, succinate-CoA ligase, ADP-forming, beta subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SUCLA2 Antibody

Anti-SUCLA2 Antibody

Target: succinate-CoA ligase, ADP-forming, beta subunit
Supplier: Atlas Antibodies
Type: Polyclonal Antibody against Human SUCLA2


  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody raised in rabbit against Human SUCLA2.
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein succinate-CoA ligase, ADP-forming, beta subunit
Target Gene SUCLA2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence FGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLP

Reactivity

항목 내용
Verified Species Reactivity Human, Mouse
Interspecies Information Mouse ENSMUSG00000022110 (96%), Rat ENSRNOG00000017481 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.