
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SUCLG2 Antibody
상품 한눈에 보기
Human SUCLG2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제됨. 고순도 및 높은 특이성을 제공하며, 인간 및 설치류 교차 반응성 확인됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051998-100 Anti-SUCLG2 Antibody, succinate-CoA ligase, GDP-forming, beta subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051998-25 Anti-SUCLG2 Antibody, succinate-CoA ligase, GDP-forming, beta subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SUCLG2 Antibody
Anti-SUCLG2 Antibody
succinate-CoA ligase, GDP-forming, beta subunit
Recommended Applications
IHC (Independent Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Independent Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC
Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against Human SUCLG2.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | succinate-CoA ligase, GDP-forming, beta subunit |
| Target Gene | SUCLG2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | FGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAKKAVASVAKK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000061838 (94%), Rat ENSRNOG00000005686 (93%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| MSDS | Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



