
Atlas Antibodies Anti-SUCLG2 Antibody
Human SUCLG2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제됨. 고순도 및 높은 특이성을 제공하며, 인간 및 설치류 교차 반응성 확인됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SUCLG2 Antibody
succinate-CoA ligase, GDP-forming, beta subunit
Recommended Applications
IHC (Independent Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Independent Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC
Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against Human SUCLG2.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | succinate-CoA ligase, GDP-forming, beta subunit |
| Target Gene | SUCLG2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | FGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAKKAVASVAKK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000061838 (94%), Rat ENSRNOG00000005686 (93%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| MSDS | Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SUCLG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUCLA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUCLG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUCLG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STYX Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|