Atlas Antibodies Anti-SUCLG2 Antibody

상품 한눈에 보기

Human SUCLG2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제됨. 고순도 및 높은 특이성을 제공하며, 인간 및 설치류 교차 반응성 확인됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA051998-100 Anti-SUCLG2 Antibody, succinate-CoA ligase, GDP-forming, beta subunit 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA051998-25 Anti-SUCLG2 Antibody, succinate-CoA ligase, GDP-forming, beta subunit 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

succinate-CoA ligase, GDP-forming, beta subunit

IHC (Independent Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC
Suitable for immunocytochemistry applications.

Polyclonal antibody against Human SUCLG2.

항목	내용
Target Protein	succinate-CoA ligase, GDP-forming, beta subunit
Target Gene	SUCLG2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	FGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAKKAVASVAKK
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000061838 (94%), Rat ENSRNOG00000005686 (93%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS	Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand