CacheBy
Atlas Antibodies Anti-SUCLG2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SUCLG2 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-SUCLG2 항체는 인간 SUCLG2 단백질을 표적으로 하는 고품질 폴리클로날 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, 독립 항체 검증을 통해 높은 특이성과 신뢰성을 제공합니다. Rabbit 유래 IgG, 친화 정제 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046705-100 Anti-SUCLG2 Antibody, succinate-CoA ligase, GDP-forming, beta subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046705-25 Anti-SUCLG2 Antibody, succinate-CoA ligase, GDP-forming, beta subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SUCLG2 Antibody

Anti-SUCLG2 Antibody

Target: succinate-CoA ligase, GDP-forming, beta subunit
Supplier: Atlas Antibodies


  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against Human SUCLG2.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein succinate-CoA ligase, GDP-forming, beta subunit
Target Gene SUCLG2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAKKAVASVAKK
Verified Species Reactivity Human
Interspecies Identity Mouse (94%), Rat (93%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.