Atlas Antibodies Anti-STIM1 Antibody

상품 한눈에 보기

Human STIM1 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합함. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제됨. 인체 단백질 발현 검증에 최적화된 고품질 연구용 시약.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA011088-100 Anti-STIM1 Antibody, stromal interaction molecule 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA011088-25 Anti-STIM1 Antibody, stromal interaction molecule 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-STIM1 Antibody

Anti-STIM1 Antibody

Target Protein: Stromal Interaction Molecule 1 (STIM1)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Orthogonal Validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human STIM1.

Alternative Gene Names: D11S4896E, GOK
Target Gene: STIM1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

TAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSH

Open Datasheet

Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity to orthologs:

Mouse ENSMUSG00000030987 (98%)
Rat ENSRNOG00000020425 (97%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.