
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-STIM1 Antibody
상품 한눈에 보기
Human STIM1 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합함. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제됨. 인체 단백질 발현 검증에 최적화된 고품질 연구용 시약.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA011088-100 Anti-STIM1 Antibody, stromal interaction molecule 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011088-25 Anti-STIM1 Antibody, stromal interaction molecule 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-STIM1 Antibody
Anti-STIM1 Antibody
Target Protein: Stromal Interaction Molecule 1 (STIM1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Orthogonal Validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against human STIM1.
Alternative Gene Names: D11S4896E, GOK
Target Gene: STIM1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSH
Verified Species Reactivity
Human
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Mouse ENSMUSG00000030987 (98%)
- Rat ENSRNOG00000020425 (97%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



