CacheBy
Atlas Antibodies Anti-STIM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STIM1 Antibody

상품 한눈에 보기

Human STIM1 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합함. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제됨. 인체 단백질 발현 검증에 최적화된 고품질 연구용 시약.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA011088-100 Anti-STIM1 Antibody, stromal interaction molecule 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011088-25 Anti-STIM1 Antibody, stromal interaction molecule 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STIM1 Antibody

Anti-STIM1 Antibody

Target Protein: Stromal Interaction Molecule 1 (STIM1)
Supplier: Atlas Antibodies


  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Orthogonal Validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human STIM1.

Alternative Gene Names: D11S4896E, GOK
Target Gene: STIM1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

TAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSH

Open Datasheet


Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Mouse ENSMUSG00000030987 (98%)
  • Rat ENSRNOG00000020425 (97%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Orthogonal Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.