
Atlas Antibodies Anti-STIM1 Antibody
상품 한눈에 보기
Human STIM1 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합함. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제됨. 인체 단백질 발현 검증에 최적화된 고품질 연구용 시약.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-STIM1 Antibody
Target Protein: Stromal Interaction Molecule 1 (STIM1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Orthogonal Validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against human STIM1.
Alternative Gene Names: D11S4896E, GOK
Target Gene: STIM1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSH
Verified Species Reactivity
Human
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Mouse ENSMUSG00000030987 (98%)
- Rat ENSRNOG00000020425 (97%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-STIM2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STIL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STIM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STEAP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STEAP3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.