CacheBy
Atlas Antibodies Anti-STEAP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STEAP3 Antibody

상품 한눈에 보기

Human STEAP3 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 고순도, 고특이성, 정교한 orthogonal validation 데이터 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA050510-100 Anti-STEAP3 Antibody, STEAP family member 3, metalloreductase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050510-25 Anti-STEAP3 Antibody, STEAP family member 3, metalloreductase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STEAP3 Antibody

Anti-STEAP3 Antibody

STEAP family member 3, metalloreductase


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Orthogonal validation)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human STEAP3


Alternative Gene Names

dudlin-2, STMP3, TSAP6

Open Datasheet


Target Information

항목 내용
Target Protein STEAP family member 3, metalloreductase
Target Gene STEAP3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRE
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000026389 (93%), Rat ENSRNOG00000049471 (91%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.