
Atlas Antibodies Anti-STEAP3 Antibody
상품 한눈에 보기
Human STEAP3 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 고순도, 고특이성, 정교한 orthogonal validation 데이터 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-STEAP3 Antibody
STEAP family member 3, metalloreductase
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Orthogonal validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. - Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human STEAP3
Alternative Gene Names
dudlin-2, STMP3, TSAP6
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | STEAP family member 3, metalloreductase |
| Target Gene | STEAP3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000026389 (93%), Rat ENSRNOG00000049471 (91%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-STIM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STEAP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STEAP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STEAP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STBD1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.