CacheBy
Atlas Antibodies Anti-SPTLC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPTLC3 Antibody

상품 한눈에 보기

인간 SPTLC3 단백질을 인식하는 폴리클로날 항체로, IHC 정량 분석에 적합합니다. PrEST 항원으로 친화 정제되었으며, RNA-seq 데이터 기반의 직교 검증을 통해 특이성이 확인되었습니다. Rabbit 유래 IgG로, PBS와 글리세롤 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048079-100 Anti-SPTLC3 Antibody, serine palmitoyltransferase, long chain base subunit 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048079-25 Anti-SPTLC3 Antibody, serine palmitoyltransferase, long chain base subunit 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPTLC3 Antibody

Anti-SPTLC3 Antibody

Target: Serine palmitoyltransferase, long chain base subunit 3 (SPTLC3)
Type: Polyclonal antibody against Human SPTLC3


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody targeting human SPTLC3, validated for immunohistochemistry and expression analysis.


Alternative Gene Names

C20orf38, FLJ11112, hLCB2b, LCB2B, SPTLC2L

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Serine palmitoyltransferase, long chain base subunit 3
Target Gene SPTLC3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVF
Verified Species Reactivity Human
Ortholog Identity Mouse ENSMUSG00000039092 (75%), Rat ENSRNOG00000004443 (74%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.