
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SPTLC3 Antibody
상품 한눈에 보기
인간 SPTLC3 단백질을 인식하는 폴리클로날 항체로, IHC 정량 분석에 적합합니다. PrEST 항원으로 친화 정제되었으며, RNA-seq 데이터 기반의 직교 검증을 통해 특이성이 확인되었습니다. Rabbit 유래 IgG로, PBS와 글리세롤 완충액에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA048079-100 Anti-SPTLC3 Antibody, serine palmitoyltransferase, long chain base subunit 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048079-25 Anti-SPTLC3 Antibody, serine palmitoyltransferase, long chain base subunit 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SPTLC3 Antibody
Anti-SPTLC3 Antibody
Target: Serine palmitoyltransferase, long chain base subunit 3 (SPTLC3)
Type: Polyclonal antibody against Human SPTLC3
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody targeting human SPTLC3, validated for immunohistochemistry and expression analysis.
Alternative Gene Names
C20orf38, FLJ11112, hLCB2b, LCB2B, SPTLC2L
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Serine palmitoyltransferase, long chain base subunit 3 |
| Target Gene | SPTLC3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVF |
| Verified Species Reactivity | Human |
| Ortholog Identity | Mouse ENSMUSG00000039092 (75%), Rat ENSRNOG00000004443 (74%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



