
Atlas Antibodies Anti-SPTLC3 Antibody
상품 한눈에 보기
인간 SPTLC3 단백질을 인식하는 폴리클로날 항체로, IHC 정량 분석에 적합합니다. PrEST 항원으로 친화 정제되었으며, RNA-seq 데이터 기반의 직교 검증을 통해 특이성이 확인되었습니다. Rabbit 유래 IgG로, PBS와 글리세롤 완충액에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPTLC3 Antibody
Target: Serine palmitoyltransferase, long chain base subunit 3 (SPTLC3)
Type: Polyclonal antibody against Human SPTLC3
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody targeting human SPTLC3, validated for immunohistochemistry and expression analysis.
Alternative Gene Names
C20orf38, FLJ11112, hLCB2b, LCB2B, SPTLC2L
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Serine palmitoyltransferase, long chain base subunit 3 |
| Target Gene | SPTLC3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVF |
| Verified Species Reactivity | Human |
| Ortholog Identity | Mouse ENSMUSG00000039092 (75%), Rat ENSRNOG00000004443 (74%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPTY2D1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPTLC3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPTLC3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPTLC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPTBN2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.