CacheBy
Atlas Antibodies Anti-SPTLC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPTLC3 Antibody

상품 한눈에 보기

인체 SPTLC3 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 오소고날 검증에 적합하며, Rabbit에서 생산된 IgG 형식. 프레스티지 항원으로 정제되어 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044247-100 Anti-SPTLC3 Antibody, serine palmitoyltransferase, long chain base subunit 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044247-25 Anti-SPTLC3 Antibody, serine palmitoyltransferase, long chain base subunit 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPTLC3 Antibody

Anti-SPTLC3 Antibody

Target: serine palmitoyltransferase, long chain base subunit 3 (SPTLC3)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human SPTLC3.


Alternative Gene Names

C20orf38, FLJ11112, hLCB2b, LCB2B, SPTLC2L

Open Datasheet


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

SYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVF

Species Reactivity

Species Reactivity Identity
Human Verified
Mouse Ortholog ENSMUSG00000039092 75%
Rat Ortholog ENSRNOG00000004443 74%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.