CacheBy
Atlas Antibodies Anti-SPTLC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPTLC1 Antibody

상품 한눈에 보기

인간 SPTLC1 단백질을 타깃으로 하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에서 검증되었으며 쥐와 생쥐에서도 높은 서열 유사성을 보임. 40% 글리세롤 및 PBS 완충액에 보존제 첨가.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010860-100 Anti-SPTLC1 Antibody, serine palmitoyltransferase, long chain base subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010860-25 Anti-SPTLC1 Antibody, serine palmitoyltransferase, long chain base subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPTLC1 Antibody

Anti-SPTLC1 Antibody

Target: serine palmitoyltransferase, long chain base subunit 1 (SPTLC1)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Independent Validation)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against human SPTLC1.


Alternative Gene Names

hLCB1, HSAN1, HSN1, LCB1, SPTI

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein serine palmitoyltransferase, long chain base subunit 1
Target Gene SPTLC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000010882): 89%
  • Mouse (ENSMUSG00000021468): 88%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.