
Thermo Fisher Scientific Aquaporin 9 Polyclonal Antibody
Aquaporin 9 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합. 합성 펩타이드를 면역원으로 사용하며, 동결건조 형태로 제공. 재구성 시 500 µg/mL 농도. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human Aquaporin 9 (amino acids 264–295) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage conditions | -20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2745934 |
Product Specific Information
The synthetic peptide sequence is:
LVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM
Add 0.2 mL of distilled water to reconstitute. This will yield a concentration of 500 µg/mL.
Target Information
Aquaporins are water-selective membrane channels. Aquaporin 9 belongs to the aquaglyceroporin subset, enabling transport of a wide range of noncharged solutes, urea, and glycerol. It may also participate in leukocyte immune responses and bactericidal activity. Multiple transcript variants are produced by alternative splicing.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 6 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 8 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 9 Polyclonal Antibody
599,200원

Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 4 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 5 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|