Thermo Fisher Scientific Aquaporin 9 Polyclonal Antibody

Applications

• Western Blot (WB): 0.1–0.5 µg/mL

Product Specifications

Product Specific Information

The synthetic peptide sequence is:
LVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM

Add 0.2 mL of distilled water to reconstitute. This will yield a concentration of 500 µg/mL.

Target Information

Aquaporins are water-selective membrane channels. Aquaporin 9 belongs to the aquaglyceroporin subset, enabling transport of a wide range of noncharged solutes, urea, and glycerol. It may also participate in leukocyte immune responses and bactericidal activity. Multiple transcript variants are produced by alternative splicing.

For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.