Thermo Fisher Scientific MBNL2 Polyclonal Antibody
Human 및 Mouse에서 반응하는 MBNL2 단백질에 대한 Rabbit Polyclonal 항체. Western blot과 ELISA에 적합하며, 고순도의 Affinity Chromatography 정제 제품. PBS/glycerol buffer에 보관되며 -20°C에서 안정적 저장 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific MBNL2 Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 160–260 of human MBNL2 (NP_6590021) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 2.64 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.01% thimerosal |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2805137 |
Product Specific Information
- Immunogen sequence:
PPVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQANQAAVAAQA - Positive Samples: A-549, HeLa, Mouse brain
- Cellular Location: Cytoplasm, Nucleus
Target Information
This gene encodes a C3H-type zinc finger protein similar to the Drosophila melanogaster muscle blind B protein. The Drosophila muscle blind gene is required for photoreceptor differentiation. Several alternatively spliced transcript variants have been described, though only some full-length forms have been determined.
⚠ WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause birth defects or other reproductive harm.
For more information, visit www.P65Warnings.ca.gov.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.