Thermo Fisher Scientific OTX2 Polyclonal Antibody
Rabbit polyclonal antibody targeting human OTX2 protein. Validated for Western blot with high specificity. Lyophilized form, reconstitutable to 500 µg/mL. Suitable for research use in developmental and transcription factor studies.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human OTX2 (258–289aa, DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746892 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
OTX2 is a 289-amino-acid protein encoding a member of the bicoid sub-family of homeodomain-containing transcription factors. It has two known alternative splice variants with distinct isoforms, though other isoforms may exist. OTX2 is an early marker of endodermal differentiation of embryonic stem cells and may play a role in the development of the brain and sensory organs. The protein may bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'. Defects in OTX2 are associated with microphthalmia syndromic type 5 (MCOPS5).
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific EBP1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific P2X5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific OTX2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Otoferlin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Oncostatin M Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|