Thermo Fisher Scientific OTX2 Polyclonal Antibody
Rabbit polyclonal antibody targeting human OTX2 protein. Validated for Western blot with high specificity. Lyophilized form, reconstitutable to 500 µg/mL. Suitable for research use in developmental and transcription factor studies.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific OTX2 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human OTX2 (258–289aa, DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746892 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
OTX2 is a 289-amino-acid protein encoding a member of the bicoid sub-family of homeodomain-containing transcription factors. It has two known alternative splice variants with distinct isoforms, though other isoforms may exist. OTX2 is an early marker of endodermal differentiation of embryonic stem cells and may play a role in the development of the brain and sensory organs. The protein may bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'. Defects in OTX2 are associated with microphthalmia syndromic type 5 (MCOPS5).
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.