Thermo Fisher Scientific EBP1 Polyclonal Antibody
EBP1 단백질을 인식하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot과 IHC(P) 실험에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도를 제공합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific EBP1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138–178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746894 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes an RNA-binding protein involved in growth regulation. The protein is present in pre-ribosomal ribonucleoprotein complexes and may participate in ribosome assembly and regulation of intermediate and late steps of rRNA processing. It interacts with the cytoplasmic domain of the ErbB3 receptor, contributing to growth regulatory signal transduction. Additionally, it acts as a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through interactions with histone deacetylases. It has been implicated in growth inhibition and differentiation induction of human cancer cells. Six pseudogenes have been identified on chromosomes 3, 6, 9, 18, 20, and X.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.