Thermo Fisher Scientific EBP1 Polyclonal Antibody
EBP1 단백질을 인식하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot과 IHC(P) 실험에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도를 제공합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138–178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746894 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes an RNA-binding protein involved in growth regulation. The protein is present in pre-ribosomal ribonucleoprotein complexes and may participate in ribosome assembly and regulation of intermediate and late steps of rRNA processing. It interacts with the cytoplasmic domain of the ErbB3 receptor, contributing to growth regulatory signal transduction. Additionally, it acts as a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through interactions with histone deacetylases. It has been implicated in growth inhibition and differentiation induction of human cancer cells. Six pseudogenes have been identified on chromosomes 3, 6, 9, 18, 20, and X.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific PARVA Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PAH Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific EBP1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific P2X5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific OTX2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|