Thermo Fisher Scientific Otoferlin Polyclonal Antibody
Thermo Fisher Scientific의 Otoferlin Polyclonal Antibody는 인간, 마우스, 랫트에 반응하는 Rabbit IgG 기반 항체입니다. Western blot과 IHC(P) 실험에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 리요필라이즈 형태로 제공되며 -20°C에 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Otoferlin (1831–1863aa QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746891 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Otoferlin은 인간의 OTOF 유전자에 의해 인코딩되는 단백질로, 이 유전자의 돌연변이는 신경감각성 비증후성 열성 난청(DFNB9)의 원인이 됩니다. 단단형(short form)은 3개의 C2 도메인과 C. elegans의 FER-1 및 인간 dysferlin에서 발견되는 단일 카복시말단 막관통 도메인을 가지며, 장단형(long form)은 6개의 C2 도메인을 포함합니다. 이러한 상동성은 본 단백질이 소포막 융합에 관여할 수 있음을 시사합니다. 여러 전사체 변이체가 보고되어 있으며, 다양한 isoform을 인코딩합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지: PA5-79776_Otoferlin_Q9HC10-1_Rabbit.svg)
(이미지: PA5-79776_Otoferlin_Q9HC10-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific P2X5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific OTX2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Otoferlin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Oncostatin M Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific OPCML Polyclonal Antibody
599,200원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|