Thermo Fisher Scientific NDRG2 Polyclonal Antibody
NDRG2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | - | 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human NDRG2 (210–247aa: NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746837 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
NDRG2 gene is a member of the N-myc downregulated gene family, which belongs to the alpha/beta hydrolase superfamily.
NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth and may be involved in glioblastoma carcinogenesis.
Several alternatively spliced transcript variants of this gene have been described, though the full-length nature of some variants has not been determined.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific NDRG2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NDRG3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NDRG2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MYLK Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Neurocan Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|