CacheBy
Atlas Antibodies Anti-SPECC1L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPECC1L Antibody

상품 한눈에 보기

Human SPECC1L 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB, ICC 응용에 적합. Rabbit 유래 IgG 형식으로 고순도 친화 정제. 인간 반응성 검증 완료 및 CYTSA, KIAA0376 대체 유전자명 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070614-100 Anti-SPECC1L Antibody, sperm antigen with calponin homology and coiled-coil domains 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070614-25 Anti-SPECC1L Antibody, sperm antigen with calponin homology and coiled-coil domains 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPECC1L Antibody

Anti-SPECC1L Antibody

Full Name: Sperm antigen with calponin homology and coiled-coil domains 1-like
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SPECC1L.


Alternative Gene Names

  • CYTSA
  • KIAA0376

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Sperm antigen with calponin homology and coiled-coil domains 1-like
Target Gene SPECC1L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000033444 (95%), Rat ENSRNOG00000001303 (93%)

Epitope Sequence:
QRHSISGPISTSKPLTALSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKT


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.