
Atlas Antibodies Anti-SPATA2L Antibody
상품 한눈에 보기
인간 SPATA2L 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC, WB(재조합 발현 검증), ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 글리세롤과 PBS 완충액에 보존됩니다. 인간 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPATA2L Antibody
Target: spermatogenesis associated 2-like (SPATA2L)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, recombinant expression validation)
- Recombinant expression validation in WB using target protein overexpression.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human SPATA2L.
Alternative Gene Names
C16orf76, MGC26885, tamo
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | spermatogenesis associated 2-like |
| Target Gene | SPATA2L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | YRSVSEPPGYQAHSCLSPGALPTLCCDTCRQLHAAHCAALPACRPGHSLRVLLGDAQRRLWLQRAQMDTLLYNS |
Verified Species Reactivity
Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000016167 | 80% |
| Mouse | ENSMUSG00000033594 | 78% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPATA31E1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPATA25 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPATA2L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPATA2L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPATA24 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.