
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SPATA24 Antibody
상품 한눈에 보기
인간 SPATA24 단백질을 인식하는 토끼 폴리클로날 항체. 정자형성과 관련된 단백질 연구에 적합. IHC, WB, ICC 등 다양한 응용에 사용 가능. 정제된 고품질 항체로 재조합 단백질 기반 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044000-100 Anti-SPATA24 Antibody, spermatogenesis associated 24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044000-25 Anti-SPATA24 Antibody, spermatogenesis associated 24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SPATA24 Antibody
Anti-SPATA24 Antibody
Target: spermatogenesis associated 24 (SPATA24)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
- WB (Recombinant expression validation): Verified by target protein overexpression in Western Blot.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against human SPATA24.
Alternative Gene Names
CCDC161, T6441
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | spermatogenesis associated 24 |
| Target Gene | SPATA24 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ESQEELIHQLRNVMVLQDENFVSKEEFQAVEKKLVEEKAAHAKTKVLLAKEEEKLQFALGEVEVLSKQLEKEKLAFEKALSSVKSKVLQESSKKDQLIT |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000019976 (95%), Mouse ENSMUSG00000024352 (94%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



