Atlas Antibodies Anti-SPATA24 Antibody

상품 한눈에 보기

인간 SPATA24 단백질을 인식하는 토끼 폴리클로날 항체. 정자형성과 관련된 단백질 연구에 적합. IHC, WB, ICC 등 다양한 응용에 사용 가능. 정제된 고품질 항체로 재조합 단백질 기반 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044000-100 Anti-SPATA24 Antibody, spermatogenesis associated 24 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044000-25 Anti-SPATA24 Antibody, spermatogenesis associated 24 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: spermatogenesis associated 24 (SPATA24)
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
WB (Recombinant expression validation): Verified by target protein overexpression in Western Blot.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody against human SPATA24.

CCDC161, T6441

항목	내용
Target Protein	spermatogenesis associated 24
Target Gene	SPATA24
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	ESQEELIHQLRNVMVLQDENFVSKEEFQAVEKKLVEEKAAHAKTKVLLAKEEEKLQFALGEVEVLSKQLEKEKLAFEKALSSVKSKVLQESSKKDQLIT
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000019976 (95%), Mouse ENSMUSG00000024352 (94%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using PrEST antigen as affinity ligand