CacheBy
Atlas Antibodies Anti-SPATA25 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPATA25 Antibody

상품 한눈에 보기

Human SPATA25 단백질을 인식하는 토끼 폴리클로날 항체로, 정자형성과 관련된 단백질 연구에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. ICC 등 다양한 응용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041386-100 Anti-SPATA25 Antibody, spermatogenesis associated 25 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041386-25 Anti-SPATA25 Antibody, spermatogenesis associated 25 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPATA25 Antibody

Anti-SPATA25 Antibody

Target Information

  • Target Protein: Spermatogenesis associated 25
  • Target Gene: SPATA25
  • Alternative Gene Names: C20orf165, dJ337O18.8, TSG23

Product Description

Polyclonal antibody against human SPATA25 protein.
Recommended for use in immunocytochemistry (ICC) and related applications.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
  • Antigen Sequence:
    SSQPDICILTLAMMIAGIPTVPVPGVREEDLIWAAQAFMMAHPEPEGAVEGARWEQAHAHTASGKMPLVRSKRGQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000015744 89%
Mouse ENSMUSG00000017767 86%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

Component Description
Buffer PBS (pH 7.2) with 40% glycerol
Preservative 0.02% sodium azide (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.