
Atlas Antibodies Anti-SPATA20 Antibody
상품 한눈에 보기
인간 SPATA20 단백질을 표적으로 하는 고품질 폴리클로날 항체. WB 및 ICC에 적합하며, 독립 항체 검증을 통해 높은 신뢰성 확보. 토끼 유래 IgG 형식으로 Affinity 정제된 제품.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPATA20 Antibody
Target: Spermatogenesis Associated 20 (SPATA20)
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB) – Independent validation using different epitopes
- Immunocytochemistry (ICC)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human SPATA20.
Alternative Gene Names
FLJ21347, SSP411, Tisp78
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Spermatogenesis associated 20 |
| Target Gene | SPATA20 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SHPSSTPQRVPNRLIHEKSPYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESFQNEEIGRLLSEDFVSVKV |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000003273 (83%), Mouse ENSMUSG00000020867 (82%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPATA2L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPATA24 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPATA20 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPATA16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPATA20 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.