
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SPATA20 Antibody
상품 한눈에 보기
인간 SPATA20 단백질을 인식하는 토끼 폴리클로날 항체로, 단백질 발현 검증 및 웨스턴블롯, 면역세포화학에 적합합니다. PrEST 항원으로 정제되었으며 높은 종간 반응성을 보입니다. 40% 글리세롤 PBS 버퍼에 보존제로 나트륨 아지드가 포함되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027144-100 Anti-SPATA20 Antibody, spermatogenesis associated 20 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027144-25 Anti-SPATA20 Antibody, spermatogenesis associated 20 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SPATA20 Antibody
Anti-SPATA20 Antibody
Target: spermatogenesis associated 20 (SPATA20)
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB) – Independent validation by comparing antibodies targeting different epitopes of the protein
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human SPATA20.
Alternative Gene Names
FLJ21347, SSP411, Tisp78
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
SHPSSTPQRVPNRLIHEKSPYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESFQNEEIGRLLSEDFVSVKV
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000003273 | 83% |
| Mouse | ENSMUSG00000020867 | 82% |
Technical Specifications
| Parameter | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



