
Atlas Antibodies Anti-SPAG9 Antibody
Human SPAG9 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 분석에 적합. RNA-seq 데이터와의 Orthogonal Validation 완료. Affinity purification 방식으로 높은 특이성과 재현성 제공. 40% glycerol 기반 완충액에 보존제 포함.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPAG9 Antibody
Target: sperm associated antigen 9 (SPAG9)
Type: Polyclonal Antibody against Human SPAG9
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody raised in rabbit against human SPAG9.
Validated for immunohistochemistry and immunocytochemistry applications.
Alternative Gene Names
CT89, FLJ13450, FLJ14006, FLJ26141, FLJ34602, HLC4, HSS, JLP, KIAA0516, MGC117291, MGC14967, MGC74461, PHET, PIG6, SYD1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | sperm associated antigen 9 |
| Target Gene | SPAG9 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSN |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity with:
- Mouse (ENSMUSG00000020859): 92%
- Rat (ENSRNOG00000002749): 90%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPAM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPAG9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPAG9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPAG6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPAG5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|