
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SPAG6 Antibody
상품 한눈에 보기
인간 SPAG6 단백질을 표적으로 하는 폴리클로날 항체로, 정자 관련 항원 6 단백질 연구에 적합합니다. IHC 및 WB에서 검증된 Orthogonal 및 Recombinant Expression Validation 제공. 토끼 유래 IgG 항체로 높은 특이성과 신뢰성을 보장합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038440-100 Anti-SPAG6 Antibody, sperm associated antigen 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038440-25 Anti-SPAG6 Antibody, sperm associated antigen 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SPAG6 Antibody
Anti-SPAG6 Antibody
Target: Sperm Associated Antigen 6 (SPAG6)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.Recombinant expression validation (WB)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human SPAG6
Alternative Gene Names
CT141, pf16, Repro-SA-1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Sperm Associated Antigen 6 |
| Target Gene | SPAG6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | AVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000022783 (92%), Rat ENSRNOG00000025787 (92%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



