CacheBy
Atlas Antibodies Anti-SPAM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPAM1 Antibody

상품 한눈에 보기

인간 SPAM1 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 WB에 적합하며 RNA-seq 데이터와의 Orthogonal Validation 지원. Rabbit 유래 IgG, PrEST 항원으로 친화 정제. 고순도, 신뢰성 높은 단백질 발현 분석용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017984-100 Anti-SPAM1 Antibody, sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017984-25 Anti-SPAM1 Antibody, sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPAM1 Antibody

Anti-SPAM1 Antibody

Target: sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding)

  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human SPAM1

Alternative Gene Names

HYAL5, PH-20, SPAG15

Open Datasheet

Target Information

항목 내용
Target Protein sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding)
Target Gene SPAM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000029678 (59%)
Rat ENSRNOG00000039466 (54%)

Antigen Sequence:

CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPM

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.