
Atlas Antibodies Anti-SPACA9 Antibody
상품 한눈에 보기
인간 SPACA9 단백질에 특이적인 폴리클로날 항체로, 정자 아크로솜 관련 단백질 연구에 적합. IHC 및 ICC 응용에 권장되며, RNA-seq 데이터와의 정합을 통한 정교한 단백질 발현 검증 가능. 토끼 유래 IgG 항체, 친화 정제 방식으로 고순도 확보.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPACA9 Antibody
Target: sperm acrosome associated 9 (SPACA9)
Type: Polyclonal Antibody against Human SPACA9
Recommended Applications
- IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody targeting human SPACA9, also known as sperm acrosome associated 9.
Alternative Gene Names
C9orf9, Mast
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | sperm acrosome associated 9 |
| Target Gene | SPACA9 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFLDICSELNKLCQHFE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000012697 (93%), Mouse ENSMUSG00000026809 (89%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPAG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPACA9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPACA9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPACA7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPACA4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.